16 releases
| 0.8.7 | Dec 9, 2025 |
|---|---|
| 0.8.6 | May 22, 2024 |
| 0.8.5 | Apr 8, 2024 |
| 0.8.4 | Dec 24, 2023 |
| 0.2.0 | Nov 18, 2021 |
#23 in Biology
110KB
769 lines
ATG
Convert your genomic reference data between formats with a single tool. ATG handles the conversion from and to GTF, GenePred(ext) and Refgene. You can generate bed files, fasta sequences or custom feature sequences. A single tool for all your conversion.
| File format | Can be used as source | Can be created |
|---|---|---|
| GTF | Yes | Yes |
| GenePred (extended) | Yes | Yes |
| RefGene | Yes | Yes |
| GenePred (simple) | No | Yes |
| Bed | No | Yes |
| Fasta | No | Yes (multiple options) |
| SpliceAI gene annotation | No | Yes |
| Quality Checks | No | Yes |
Reasons to use ATG
- No need to maintain multiple tools for one-way conversions (
gtfToGenePred,genePredToGtf, etc). ATG handles many formats and can convert in both directions. - Speed: ATG is really fast - almost twice as fast as
gtfToGenePred. - Robust parser: It handles GTF, GenePred with all extras according to spec.
- Low memory footprint: It also runs on machines with little RAM.
- Extra features, such as quality control and correctness checks.
- Open for contributions: Every help is welcome improve ATG or to add more functionality.
- You can also use ATG as a library for your own Rust projects.
ATG command line tool
Install
There are currently 3 different options how to install ATG:
cargo
The easiest way to install ATG is to use cargo (if you have cargo and rust installed)
cargo install atg
Pre-built binaries
You can download pre-built binaries for Linux and Mac from Github.
From source
You can also build ATG from source (if you have the rust toolchains installed):
git clone https://github.com/anergictcell/atg.git
cd atg
cargo build --release
Usage
The main CLI arguments are
-f,--from: Specify the file format of the source (e.g.gtf,genepredext,refgene)-t,--to: Specify the target file format (e.g.gtf,genepred,bed,fastaetc)-i,--input: Path to source file. (Use/dev/stdinif you are using atg in a pipe)-o,--output: Path to target file. Existing files will be overwritten. (Use/dev/stdoutif you are using atg in a pipe)-v,-vv,-vvv: Verbosity (info, debug, trace)-h,--help: Print the help dialog with detailed usage instructions.
Additional, optional arguments:
-g,--gtf-source: Specify the source for GTF output files. Defaults toatg-r,--reference: Path of a reference genome fasta file. Required for fasta output-c,--genetic-code: Specify which genetic code to use for translating the transcripts. Genetic codes can be specified per chromosome by specifying the chromsome and the code, separated by:(e.g.-c chrM:vertebrate mitochondrial). They can also be specified for all chromsomes by omitting the chromosome (e.g.-c vertebrate mitochondrial). The argument can be specified multiple times (e.g:-c "standard" -c "chrM:vertebrate mitochondrial" -c "chrAYN:alternative yeast nuclear"). The code names are based on thenamefield from the NCBI specs but all lowercase characters. Alternatively, you can also specify the amino acid lookup table directly:-c "chrM:FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSS**VVVVAAAADDEEGGGG". Defaults tostandard.-q,--qc-check: Specify QC-checks for removing transcripts from the output
Examples:
## Convert a GTF file to a RefGene file
atg --from gtf --to refgene --input /path/to/input.gtf --output /path/to/output.refgene
## Convert a GTF file to a GenePred file
atg --from gtf --to genepred --input /path/to/input.gtf --output /path/to/output.genepred
## Convert a GTF file to a GenePredExt file
atg --from gtf --to genepredext --input /path/to/input.gtf --output /path/to/output.genepredext
## Convert RefGene to GTF
atg --from refgene --to gtf --input /path/to/input.refgene --output /path/to/output.gtf
## Convert RefGene to bed
atg --from refgene --to bed --input /path/to/input.refgene --output /path/to/output.bed
## Convert a GTF file to a RefGene file, remove all transcript without proper start and stop codons
atg --from gtf --to refgene --input /path/to/input.gtf --output /path/to/output.refgene --qc-check start --qc-check stop --reference /path/to/fasta.fa
Supported --output formats
gtf
Output in GTF format.
chr9 ncbiRefSeq.2021-05-17 transcript 74526555 74600974 . + . gene_id "C9orf85"; transcript_id "NM_001365057.2";
chr9 ncbiRefSeq.2021-05-17 exon 74526555 74526752 . + . gene_id "C9orf85"; transcript_id "NM_001365057.2";
chr9 ncbiRefSeq.2021-05-17 5UTR 74526555 74526650 . + . gene_id "C9orf85"; transcript_id "NM_001365057.2";
chr9 ncbiRefSeq.2021-05-17 CDS 74526651 74526752 . + 0 gene_id "C9orf85"; transcript_id "NM_001365057.2";
chr9 ncbiRefSeq.2021-05-17 exon 74561922 74562028 . + . gene_id "C9orf85"; transcript_id "NM_001365057.2";
chr9 ncbiRefSeq.2021-05-17 CDS 74561922 74562026 . + 0 gene_id "C9orf85"; transcript_id "NM_001365057.2";
...
You can specify the value of the source column manually using the --gtf-source/-g option. Defaults to atg
refgene
Output in the refGene format, as used by some UCSC and NCBI RefSeq services
0 NM_001101.5 chr7 - 5566778 5570232 5567378 5569288 6 5566778,5567634,5567911,5568791,5569165,5570154, 5567522,5567816,5568350,5569031,5569294,5570232, 0 ACTB cmpl cmpl 0,1,0,0,0,-1,
0 NM_001203247.2 chr7 - 148504474 148581383 148504737 148544390 20 148504474,148506162,148506401,148507424,148508716,148511050,148512005,148512597,148513775,148514313,148514968,148516687,148523560,148524255,148525831,148526819,148529725,148543561,148544273,148581255, 148504798,148506247,148506482,148507506,148508812,148511229,148512131,148512638,148513870,148514483,148515209,148516779,148523724,148524358,148525972,148526940,148529842,148543690,148544397,148581383, 0 EZH2 cmpl cmpl 2,1,1,0,0,1,1,2,0,1,0,1,2,1,1,0,0,0,0,-1,
0 NM_001203248.2 chr7 - 148504474 148581383 148504737 148544390 20 148504474,148506162,148506401,148507424,148508716,148511050,148512005,148512597,148513775,148514313,148514968,148516687,148523560,148524255,148525831,148526819,148529725,148543588,148544273,148581255, 148504798,148506247,148506482,148507506,148508812,148511229,148512131,148512638,148513870,148514483,148515209,148516779,148523724,148524358,148525972,148526940,148529842,148543690,148544397,148581383, 0 EZH2 cmpl cmpl 2,1,1,0,0,1,1,2,0,1,0,1,2,1,1,0,0,0,0,-1,
0 NM_001354750.2 chr11 + 113930432 114127487 113934022 114121277 7 113930432,113933932,114027058,114057673,114112888,114117919,114121047, 113930864,113935290,114027156,114057760,114113059,114118087,114127487, 0 ZBTB16 cmpl cmpl -1,0,2,1,1,1,1,
genepred(ext)
Output in the GenePred(Ext) format, as used by some UCSC and NCBI RefSeq services
GenePred:
NM_001101.5 chr7 - 5566778 5570232 5567378 5569288 6 5566778,5567634,5567911,5568791,5569165,5570154, 5567522,5567816,5568350,5569031,5569294,5570232,
NM_001203247.2 chr7 - 148504474 148581383 148504737 148544390 20 148504474,148506162,148506401,148507424,148508716,148511050,148512005,148512597,148513775,148514313,148514968,148516687,148523560,148524255,148525831,148526819,148529725,148543561,148544273,148581255, 148504798,148506247,148506482,148507506,148508812,148511229,148512131,148512638,148513870,148514483,148515209,148516779,148523724,148524358,148525972,148526940,148529842,148543690,148544397,148581383,
NM_001203248.2 chr7 - 148504474 148581383 148504737 148544390 20 148504474,148506162,148506401,148507424,148508716,148511050,148512005,148512597,148513775,148514313,148514968,148516687,148523560,148524255,148525831,148526819,148529725,148543588,148544273,148581255, 148504798,148506247,148506482,148507506,148508812,148511229,148512131,148512638,148513870,148514483,148515209,148516779,148523724,148524358,148525972,148526940,148529842,148543690,148544397,148581383,
NM_001354750.2 chr11 + 113930432 114127487 113934022 114121277 7 113930432,113933932,114027058,114057673,114112888,114117919,114121047, 113930864,113935290,114027156,114057760,114113059,114118087,114127487,
GenePredExt
NM_001101.5 chr7 - 5566778 5570232 5567378 5569288 6 5566778,5567634,5567911,5568791,5569165,5570154, 5567522,5567816,5568350,5569031,5569294,5570232, 0 ACTB cmpl cmpl 0,1,0,0,0,-1,
NM_001203247.2 chr7 - 148504474 148581383 148504737 148544390 20 148504474,148506162,148506401,148507424,148508716,148511050,148512005,148512597,148513775,148514313,148514968,148516687,148523560,148524255,148525831,148526819,148529725,148543561,148544273,148581255, 148504798,148506247,148506482,148507506,148508812,148511229,148512131,148512638,148513870,148514483,148515209,148516779,148523724,148524358,148525972,148526940,148529842,148543690,148544397,148581383, 0 EZH2 cmpl cmpl 2,1,1,0,0,1,1,2,0,1,0,1,2,1,1,0,0,0,0,-1,
NM_001203248.2 chr7 - 148504474 148581383 148504737 148544390 20 148504474,148506162,148506401,148507424,148508716,148511050,148512005,148512597,148513775,148514313,148514968,148516687,148523560,148524255,148525831,148526819,148529725,148543588,148544273,148581255, 148504798,148506247,148506482,148507506,148508812,148511229,148512131,148512638,148513870,148514483,148515209,148516779,148523724,148524358,148525972,148526940,148529842,148543690,148544397,148581383, 0 EZH2 cmpl cmpl 2,1,1,0,0,1,1,2,0,1,0,1,2,1,1,0,0,0,0,-1,
NM_001354750.2 chr11 + 113930432 114127487 113934022 114121277 7 113930432,113933932,114027058,114057673,114112888,114117919,114121047, 113930864,113935290,114027156,114057760,114113059,114118087,114127487, 0 ZBTB16 cmpl cmpl -1,0,2,1,1,1,1,
bed
Output in bed format.
chr7 5566778 5570232 ACTB:NM_001101.5 - 5567378 5569288 212,16,48 6 744,182,439,240,129,78 0,856,1133,2013,2387,3376
chr11 113930432 114127487 ZBTB16:NM_001354750.2 + 113934022 114121277 212,16,48 7 432,1358,98,87,171,168,6440 0,3500,96626,127241,182456,187487,190615
chr17 40852292 40897058 EZH1:NM_001321082.2 - 40854549 40880959 212,16,48 20 2318,85,81,82,96,179,126,41,92,197,181,92,164,103,177,121,129,128,91,30 0,2602,3465,4327,4813,5732,7683,8601,9571,12014,12934,17701,18179,18830,19998,22520,27360,28550,30553,44736
fasta
Writes the cDNA sequence of all transcripts into one file. Please note that the sequence is stranded.
This target format requires a reference genome fasta file that must be specified using --reference/-r.
This output allows different --fasta-format options:
transcript: The full transcript sequence (from the genomic start to end position, including introns)exons: The cDNA sequence of the processed transcript, i.e. the sequence of all exons, including non-coding exons.cds(default): The CDS of the transcript
>NM_007298.3 BRCA1
ATGGATTTATCTGCTCTTCGCGTTGAAGAAGTACAAAATGTCATTAATGC
TATGCAGAAAATCTTAGAGTGTCCCATCTGTCTGGAGTTGATCAAGGAAC
CTGTCTCCACAAAGTGTGACCACATATTTTGCAAATTTTGCATGCTGAAA
CTTCTCAACCAGAAGAAAGGGCCTTCACAGTGTCCTTTATGTAAGAATGA
TATAACCAAAAGGAGCCTACAAGAAAGTACGAGATTTAGTCAACTTGTTG
...
>NM_001365057.2 C9orf85
ATGAGCTCCCAGAAAGGCAACGTGGCTCGTTCCAGACCTCAGAAGCACCA
GAATACGTTTAGCTTCAAAAATGACAAGTTCGATAAAAGTGTGCAGACCA
AGAAAATTAATGCAAAACTTCATGATGGAGTATGTCAGCGCTGTAAAGAA
GTTCTTGAGTGGCGTGTAAAATACAGCAAATACAAACCATTATCAAAACC
TAAAAAGTGA
...
fasta-split
Like fasta above, but one file for each transcript. Instead of an output file, you must specify an output directory, ATG will save each transcript as <Transcript_name>.fasta, e.g.: NM_001365057.2.fasta.
This target format requires a reference genome fasta file that must be specified using --reference/-r.
This output allows different --fasta-format options:
transcript: The full transcript sequence (from the genomic start to end position, including introns)exons: The cDNA sequence of the processed transcript, i.e. the sequence of all exons, including non-coding exons.cds(default): The CDS of the transcript
feature-sequence
cDNA sequence of each feature (5' UTR, CDS, 3'UTR), each in a separate row.
This target format requires a reference genome fasta file that must be specified using --reference/-r.
BRCA1 NM_007298.3 chr17 41196311 41197694 - 3UTR CTGCAGCCAGCCAC...
BRCA1 NM_007298.3 chr17 41197694 41197819 - CDS CAATTGGGCAGATGTGTG...
BRCA1 NM_007298.3 chr17 41199659 41199720 - CDS GGTGTCCACCCAATTGTG...
BRCA1 NM_007298.3 chr17 41201137 41201211 - CDS ATCAACTGGAATGGATGG...
BRCA1 NM_007298.3 chr17 41203079 41203134 - CDS ATCTTCAGGGGGCTAGAA...
BRCA1 NM_007298.3 chr17 41209068 41209152 - CDS CATGATTTTGAAGTCAGA...
BRCA1 NM_007298.3 chr17 41215349 41215390 - CDS GGGTGACCCAGTCTATTA...
BRCA1 NM_007298.3 chr17 41215890 41215968 - CDS ATGCTGAGTTTGTGTGTG...
BRCA1 NM_007298.3 chr17 41219624 41219712 - CDS ATGCTCGTGTACAAGTTT...
BRCA1 NM_007298.3 chr17 41222944 41223255 - CDS AGGGAACCCCTTACCTGG...
C9orf85 NM_001365057.2 chr9 74526555 74526650 + 5UTR ATTGACAGAA...
C9orf85 NM_001365057.2 chr9 74526651 74526752 + CDS ATGAGCTCCCAGAA...
C9orf85 NM_001365057.2 chr9 74561922 74562028 + CDS AAAATTAATGCAAA...
C9orf85 NM_001365057.2 chr9 74597573 74597573 + CDS A
C9orf85 NM_001365057.2 chr9 74597574 74600974 + 3UTR TGGAGTCTCC...
spliceai
This is a custom format useful for SpliceAI splice predictions. The repo lists example files. The output has one gene per row, each gene record contains a consensus transcript, created by merging overlapping exons.
#NAME CHROM STRAND TX_START TX_END EXON_START EXON_END
OR4F5 1 + 69090 70008 69090, 70008,
AL627309.1 1 - 134900 139379 134900,137620, 135802,139379,
qc
Runs some basic consistency checks on the transcripts:
| QC check | Explanation | Non-Coding vs Coding | requires Fasta File |
|---|---|---|---|
| Exon | Contains at least one exon | all | no |
| Correct CDS Length | The length of the CDS is divisible by 3 | Coding | no |
| Correct Start Codon | The CDS starts with ATG |
Coding | yes |
| Correct Stop Codon | The CDS ends with a Stop codon TAG, TAA, or TGA |
Coding | yes |
| No upstream Start Codon | The 5'UTR does not contain another start codon ATG (This test do not make sense biologically. It is totally fine for a transcript to have upstream ATG start cordons that are not utilized but the ribosome.) |
Coding | yes |
| No upstream Stop Codon | The CDS does not contain another in-frame stop-codon | Coding | yes |
| No Start codon | The full exon sequence does not contain a start codon ATG (Biologically speaking, a non-coding transcript could have ATG start codons that are not utilized) |
Non-Coding | yes |
| Correct Coordinates | The transcript is within the coordinates of the reference genome | all | yes |
Test results:
NATest could not be performed (e.g. CDS-length for non-coding transcripts), so no conclusion could be drawnOKThe test succeeded with an OK resultsNOKThe test failed and gave a NOT OK result
Gene transcript Exon CDS Length Correct Start Codon Correct Stop Codon No upstream Start Codon No upstream Stop Codon Correct Coordinates
FAM239A NR_146581.1 OK N/A N/A N/A OK N/A OK
OR5H2 NM_001005482.1 OK OK OK OK OK OK OK
SNX20 NM_001144972.2 OK OK OK OK NOK OK OK
raw
This is mainly useful for debugging, as it gives a quick glimpse into the Exons and CDS coordinates of the transcripts.
bin
Save Transcripts in ATG binary format for faster re-reading.
ATG as library
ATG uses the atglib library, which is documented inline and available on docs.rs
Known issues
GTF parsing
- NM_001371720.1 has two book-ended exons (155160639-155161619 || 155161620-155162101). During input parsing, book-ended features are merged into one exon
Dependencies
~43MB
~585K SLoC